If you have been reading about LC-MS/MS and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Last reviewed on 2026-05-12. Where a claim depends on a specific study, the study is described rather than over-claimed.
Regulatory treatment of cardarine differs by context and jurisdiction. In competitive sport, the World Anti-Doping Agency lists PPARδ agonists, including GW501516, as prohibited at all times. Outside sport, it lacks approval as a prescription medicine in major drug markets, and products sold for human consumption may be treated as unapproved drugs. Some countries also restrict importation or sale through general consumer protection and medicines laws. These classifications affect availability, testing, and legal risk without establishing therapeutic value.
Because cardarine is not an approved medicine, no pharmacopeial monograph defines its identity, purity, or storage requirements. Laboratories typically rely on in-house methods and reference standards when testing materials labeled as GW501516. Certificates of analysis may report purity and identity for a specific batch, but their scope varies and they do not guarantee safety or legal status. Independent verification can include high-performance liquid chromatography, mass spectrometry, nuclear magnetic resonance, and elemental analysis. The distinction between research chemical labeling and human use is significant because quality standards and oversight differ.
A common misconception is that cardarine has been proven safe for human use. In reality, human clinical data are limited, and long-term animal studies have raised concerns about cancer. Another misconception is that it is a supplement or vitamin-like compound. It is a synthetic research chemical with no approved medical indication. Scientific discussion often focuses on its mechanism and detection rather than therapeutic use. Regulatory and anti-doping literature treats it primarily as a prohibited substance.
Cardarine is explicitly prohibited by the World Anti-Doping Agency under the class of PPARδ agonists. Its presence in urine or blood samples can be detected using mass spectrometry-based methods, often liquid chromatography-tandem mass spectrometry. Athletes who test positive may face sanctions, including bans from competition. The compound is also regulated as a prescription-only or unapproved drug in many countries. Enforcement varies by jurisdiction, and some regions treat it as a controlled substance. Online sales may occur despite these restrictions, creating quality and legal risks.
Laboratory detection of cardarine typically involves sample preparation followed by chromatographic separation and mass spectrometric identification. Urine is the most common matrix for anti-doping tests, though blood and hair have also been explored. Methods can target the parent compound or its metabolites, depending on the expected window of detection. Reference standards are required for accurate quantification. Matrix effects and dilution can influence results, so laboratories use internal standards and validation protocols. The exact detection window varies with dose, route, and individual metabolism.
| Property | Value | Notes |
|---|---|---|
| WADA classification | S4 Hormone and Metabolic Modulators | Prohibited at all times in sport. |
| Drug approval status | Not approved in major jurisdictions | No accepted therapeutic indication. |
| Common detection method | LC-MS/MS | Detects parent compound and metabolites. |
| Typical test matrix | Urine or blood | Urine is common in anti-doping testing. |
| Product labeling | Research chemical or supplement | Often not independently verified. |
Lebanon is a city in and the county seat of Boone County, Indiana, United States. The population was 16,662 at the 2020 census. Lebanon is located in central Indiana, approximately 29 miles (47 km) northwest of downtown Indianapolis and 36 miles (58 km) southeast of Lafayette.
All committees have an allotted budget to which they must adhere. Any committee may start a project. If a project's spending becomes too much for a committee to continue funding, it must take the issue to the Project Committee. The project committee either increases the budget or decides on an external funding plan. The Bureau and Executive Committee oversee operations of the other committees.
== Causes == Few urethral diverticula are present at birth; the vast majority are acquired. Acquired urethral diverticula can be caused by trauma and/or infection. When the peri-urethral ducts become infected repeatedly, they can become blocked and eventually cause a diverticulum. They are usually found in the middle of the urethra or the end farthest from the bladder. Congenital urethral diverticula can arise from several embryological sources. These include defects in the primordial folds and remnants of Gartner's duct.
=== In organic synthesis === Chloral hydrate is a starting point for the synthesis of other organic compounds. It is the starting material for the production of chloral, which is produced by the distillation of a mixture of chloral hydrate and sulfuric acid, which serves as the desiccant. Notably, it is used to synthesize isatin. In this synthesis, chloral hydrate reacts with aniline and hydroxylamine to give a condensation product which cyclicizes in sulfuric acid to give the target compound:
Effective on new passenger cars sold in the United States after January 1, 1964. front outboard lap belts were required. On September 9, 1966, the National Traffic and Motor Vehicle Safety Act became law in the U.S., the first mandatory federal safety standards for motor vehicles. Effective in 1966, US-market passenger cars were required to be equipped with padded instrument panels, front and rear outboard lap belts, and white reverse (backup) lamps. In 1966, the U.S. established the United States Department of Transportation (DOT) with automobile safety as one of its purposes. The National Transportation Safety Board (NTSB) was created as an independent organization on April 1, 1967, but was reliant on the DOT for administration and funding. However, in 1975 the organization was made completely independent by the Independent Safety Board Act (in P.L. 93-633; 49 U.S.C. 1901). In 1967, equipment specifications by such major fleet purchasers as the City and County of Los Angeles, California, encouraged the voluntary installation in most new cars sold in the US of safety devices, systems, and design features including:
Sources: en.wikipedia.org
Early measurements of coaxial stacking were performed using biochemical assays that studies the relative migration of different nucleic acid molecules based on their conformation and the kind of interactions present. Short DNA molecules containing nicks that could still stack coaxially migrated faster than DNA molecules containing gaps and thus had no coaxial stacking. This could be explained by polymeric properties of DNA where are more rigid rod like molecule will migrate faster along an electrical gradient in a matrix compared to a more flexible molecule. Development of newer techniques such as optical tweezers and the ability to fold DNA nanostructures led to measurement so of DNA bundles and their ability to stack with each other. The force needed to pull these bundles apart using optical tweezers could then be analyzed to measure the base-pair stacking energies. These measurements were performed mainly under non-equilibrium conditions and various extrapolations were made to arrive at the exact values of coaxial stacking between bases. Recent single-molecule studies using DNA nanostructures and DNA-PAINT super-resolution microscopy has allowed for measurement of these interaction between dinucleotides using in-depth kinetic analysis of binding times of short DNA molecules to their complimentary sequences in the presence or absence of DNA-stacking interactions.
A blood glucose meter is an electronic device for measuring the blood glucose level. A relatively small drop of blood is placed on a disposable test strip which interfaces with a digital meter. Within several seconds, the level of blood glucose will be shown on the digital display. Needing only a small drop of blood for the meter means that the time and effort required for testing are reduced and the compliance of diabetic people to their testing regimens is improved significantly. Blood glucose meters provide results in various units such as eAG (mg/dL) and eAG (mmol/L), and may also estimate A1C levels. These measurements can aid in classifying blood glucose levels as normal, prediabetic, or diabetic, facilitating effective diabetes management for users. While some models offer interpretative features that indicate the health status based on these results, not all meters provide this functionality, focusing instead on providing raw glucose measurements. Users of blood glucose meters without interpretative features can utilize online calculators to determine their blood glucose status based on measured values. The cost of using blood glucose meters is believed to be a cost-benefit relative to the avoided medical costs of the complications of diabetes. Recent advances include:
Phospholipase D2 (PLD2) binds PIP2 and localizes with lipid rafts. Increases in cholesterol overcome PIP2 binding and sequester PLD2 into GM1 lipid rafts away from its substrate phosphatidylcholine. Efflux of cholesterol causes PLD2 to translocate to PIP2 domains where it is activated by substrate presentation. Both PIP2 signaling and cholesterol signaling regulate the enzyme. Angiotensin converting enzyme (ACE2) is regulated by PIP2 localization. The ACE2 enzyme is palmitoylated which drives the protein into GM1 lipids. The enzyme also bind to PIP2 which moves it out of the endocytic pathway. The drug hydroxychloroquine blocks ACE2 interaction with PIP2 in multiple cell types shifting its localization. PIP2 binding proteins PH domain PIP2/palmitate proteins GABAA receptor
== Further information == Thorium, from which 233U is bred, is roughly three to four times more abundant in the Earth's crust than uranium. The decay chain of 233U itself is part of the neptunium series, the decay chain of its grandparent 237Np. Uses for uranium-233 include the production of the medical isotopes actinium-225 and bismuth-213 which are among its daughters, low-mass nuclear reactors for space travel applications, use as an isotopic tracer, nuclear weapons research, and reactor fuel research including the thorium fuel cycle. Bismuth-213 has been investigated for use in cancer treatment. However, producing the medical isotopes from 233U practically requires separating the long-lived intermediate thorium-229. At Oak Ridge, thorium-229 is recovered from stored uranium-233 and supplied to TerraPower Isotopes for the production of actinium-225 used in cancer-treatment research.
==== Toxicity of desomorphine ==== Animal studies comparing pure desomorphine to morphine showed it to have increased toxicity, more potent relief of pain, higher levels of sedation, decreased respiration, and increased digestive activity.
Sources: en.wikipedia.org
=== Reorganisation === In 1956, the Government of India effected a comprehensive re-organisation of provincial boundaries, based upon the principle of shared language. As a result of the States Reorganisation Act on 1 November 1956, the Kannada-speaking districts of Belgaum (exclusing Chandgad), Bijapur, Dharwad, and North Canara were transferred from Bombay to Mysore. South Canara was transferred from Madras; and Koppal, Raichur, Kalaburagi and Bidar districts from Hyderabad. Also, the small Coorg State was merged, becoming a district in Mysore. The state was renamed Karnataka on 1 November 1973.
=== Medical management === A significant portion of patients with cholestasis (80%) will experience pruritus at some point during their disease. This is a condition that can severely decrease a patient's quality of life as it can impact sleep, concentration, work ability, and mood. Many treatments exist, but how effective each option is depends on the patient and their condition. Assessment using a scale, such as a visual analogue scale or a 5-D itch scale will be useful to identify an appropriate treatment. Possible treatment options include antihistamines, ursodeoxycholic acid, and phenobarbital. Nalfurafine hydrochloride can also be used to treat pruritus caused by chronic liver disease and was recently approved in Japan for this purpose. Bile acid binding resins like cholestyramine are the most common treatment. Side effects of this treatment are limited and include constipation and bloating. Other commonly used treatments include rifampin, naloxone, and sertraline. In cholestatic liver disease, when bilirubin concentration starts to build up, a deficiency of fat soluble vitamins may also occur. To manage this, doses of vitamin A, D, E, and K are recommended to retain appropriate vitamin levels. Cholestatic liver disease can impact lipids, and possibly lead to dyslipidemia, which may present a risk for coronary artery disease. Statins and fibrates are generally used as lipid lowering therapy to treat patients with cholestatic liver disease. For intrahepatic cholestasis in pregnant women, S-adenosylmethionine has proven to be an effective treatment.
Two polypeptides. A large subunit of 104 amino acids (sequence TMWGTKWCGSGNEATDISELGYWSNLDSCCRTHDHCDNIPSGQTKYGLTNEGKYTMMNCKCETAFEQCLRNVTGGMEGPAAGFVRKTYFDLYGNGCYNVQCPSQ) and a smaller one of 27 amino acids (sequence SEECPDGVATYTGEAGYGAWAINKLNG). Subunits are linked by a disulfide bond. Phospholipase A2 (PLA2) activity on the large subunit. The molecular weight of the toxin is 15 kDa. Like IpTxa, IpTxi acts on RyR. When an action potential reaches the muscle, RyR channels open and Ca2+ becomes available in the cell to induce contraction. The presence of Ca2+ induces the large subunit of IpTxi to hydrolyze the Sn2 fatty acyl bond from the membrane of the sarcoplasmatic reticulum. This process is executed by PLA2 activity. The freed fatty acids bind to the RyR itself or to a closely associated protein linked to gating. Binding of the RyR induces blocking of the channel. When the concentration of free fatty acids is low there will be an incomplete block of RyR; higher concentrations will give a complete block. Because IpTxi also works on the RyR channels of the heart muscles, it could potentially be used as a drug against arrhythmia. This has not yet been proven, and must be studied in vivo first.
It is responsible for growth and development of bone and muscles. The typical mutation, R202H, makes the inhibitor FKBP1A bind less tightly to the activation GS-loop. The result is that ACVR1 is not effectively turned off, and an overgrowth of bone and cartilage and fusion of joints occurs. Atypical mutations involving other residues work similarly. In some cases, the receptor can end up signalling that it's active without being bound to its activating ligand. Most cases of FOP are the result of a new gene mutation: these people had no history of this particular disorder in their family. There are some cases where the individual has inherited the mutation from one affected parent.
In the context of chemistry, energy is an attribute of a substance as a consequence of its atomic, molecular or aggregate structure. Since a chemical transformation is accompanied by a change in one or more of these kinds of structures, it is invariably accompanied by an increase or decrease of energy of the substances involved. Some energy is transferred between the surroundings and the reactants of the reaction in the form of heat or light; thus the products of a reaction may have more or less energy than the reactants. A reaction is said to be exergonic if the final state is lower on the energy scale than the initial state; in the case of endergonic reactions the situation is the reverse. A reaction is said to be exothermic if the reaction releases heat to the surroundings; in the case of endothermic reactions, the reaction absorbs heat from the surroundings. Chemical reactions are invariably not possible unless the reactants surmount an energy barrier known as the activation energy. The speed of a chemical reaction (at given temperature T) is related to the activation energy E, by the Boltzmann's population factor
Sources: en.wikipedia.org
Anti-doping laboratories typically use LC-MS/MS to detect GW501516 and its metabolites in urine. The method is sensitive and can identify the compound at low concentrations. Detection depends on sample timing, metabolism, and the specific assay.
Legality varies by country and context. It lacks marketing approval as a medicine in major countries. Sports organizations prohibit its use at all times.
A certificate of analysis may report identity, purity, and testing methods for a specific batch. It does not guarantee safety or legal status. Independent verification can confirm whether the material matches the label.
Yes, WADA prohibits cardarine as a PPARδ agonist. It appears on the prohibited list and can be detected in urine or blood. Athletes using it risk sanctions.